Anti HBS1L pAb (ATL-HPA029728)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029728-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HBS1L
Alternative Gene Name: DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019977: 95%, ENSRNOG00000014531: 95%
Entrez Gene ID: 10767
Uniprot ID: Q9Y450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF |
Gene Sequence | CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF |
Gene ID - Mouse | ENSMUSG00000019977 |
Gene ID - Rat | ENSRNOG00000014531 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HBS1L pAb (ATL-HPA029728) | |
Datasheet | Anti HBS1L pAb (ATL-HPA029728) Datasheet (External Link) |
Vendor Page | Anti HBS1L pAb (ATL-HPA029728) at Atlas Antibodies |
Documents & Links for Anti HBS1L pAb (ATL-HPA029728) | |
Datasheet | Anti HBS1L pAb (ATL-HPA029728) Datasheet (External Link) |
Vendor Page | Anti HBS1L pAb (ATL-HPA029728) |