Anti HBS1L pAb (ATL-HPA029728)

Atlas Antibodies

Catalog No.:
ATL-HPA029728-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HBS1-like translational GTPase
Gene Name: HBS1L
Alternative Gene Name: DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019977: 95%, ENSRNOG00000014531: 95%
Entrez Gene ID: 10767
Uniprot ID: Q9Y450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Gene Sequence CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Gene ID - Mouse ENSMUSG00000019977
Gene ID - Rat ENSRNOG00000014531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HBS1L pAb (ATL-HPA029728)
Datasheet Anti HBS1L pAb (ATL-HPA029728) Datasheet (External Link)
Vendor Page Anti HBS1L pAb (ATL-HPA029728) at Atlas Antibodies

Documents & Links for Anti HBS1L pAb (ATL-HPA029728)
Datasheet Anti HBS1L pAb (ATL-HPA029728) Datasheet (External Link)
Vendor Page Anti HBS1L pAb (ATL-HPA029728)