Anti HBA1 pAb (ATL-HPA043780)

Atlas Antibodies

Catalog No.:
ATL-HPA043780-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: hemoglobin, alpha 1
Gene Name: HBA1
Alternative Gene Name: HBA-T3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069919: 76%, ENSRNOG00000047321: 70%
Entrez Gene ID: 3039
Uniprot ID: P69905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Gene Sequence MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Gene ID - Mouse ENSMUSG00000069919
Gene ID - Rat ENSRNOG00000047321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HBA1 pAb (ATL-HPA043780)
Datasheet Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link)
Vendor Page Anti HBA1 pAb (ATL-HPA043780) at Atlas Antibodies

Documents & Links for Anti HBA1 pAb (ATL-HPA043780)
Datasheet Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link)
Vendor Page Anti HBA1 pAb (ATL-HPA043780)