Anti HBA1 pAb (ATL-HPA043780)
Atlas Antibodies
- SKU:
- ATL-HPA043780-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: HBA1
Alternative Gene Name: HBA-T3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069919: 76%, ENSRNOG00000047321: 70%
Entrez Gene ID: 3039
Uniprot ID: P69905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF |
Gene Sequence | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF |
Gene ID - Mouse | ENSMUSG00000069919 |
Gene ID - Rat | ENSRNOG00000047321 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HBA1 pAb (ATL-HPA043780) | |
Datasheet | Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link) |
Vendor Page | Anti HBA1 pAb (ATL-HPA043780) at Atlas Antibodies |
Documents & Links for Anti HBA1 pAb (ATL-HPA043780) | |
Datasheet | Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link) |
Vendor Page | Anti HBA1 pAb (ATL-HPA043780) |