Anti HBA1 pAb (ATL-HPA043780)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043780-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: HBA1
Alternative Gene Name: HBA-T3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069919: 76%, ENSRNOG00000047321: 70%
Entrez Gene ID: 3039
Uniprot ID: P69905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF |
| Gene Sequence | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF |
| Gene ID - Mouse | ENSMUSG00000069919 |
| Gene ID - Rat | ENSRNOG00000047321 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HBA1 pAb (ATL-HPA043780) | |
| Datasheet | Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link) |
| Vendor Page | Anti HBA1 pAb (ATL-HPA043780) at Atlas Antibodies |
| Documents & Links for Anti HBA1 pAb (ATL-HPA043780) | |
| Datasheet | Anti HBA1 pAb (ATL-HPA043780) Datasheet (External Link) |
| Vendor Page | Anti HBA1 pAb (ATL-HPA043780) |