Anti HAUS8 pAb (ATL-HPA039406)

Atlas Antibodies

Catalog No.: ATL-HPA039406-25

Protein Description: HAUS augmin-like complex, subunit 8
Gene Name: HAUS8
Alternative Gene Name: HICE1, MGC20533, NY-SAR-48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035439: 47%, ENSRNOG00000052038: 47%
Entrez Gene ID: 93323
Uniprot ID: Q9BT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
• Gene Sequence: ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
• Gene ID - Mouse: ENSMUSG00000035439
• Gene ID - Rat: ENSRNOG00000052038
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.