Anti HAUS8 pAb (ATL-HPA039406)

Atlas Antibodies

Catalog No.:
ATL-HPA039406-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HAUS augmin-like complex, subunit 8
Gene Name: HAUS8
Alternative Gene Name: HICE1, MGC20533, NY-SAR-48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035439: 47%, ENSRNOG00000052038: 47%
Entrez Gene ID: 93323
Uniprot ID: Q9BT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
Gene Sequence ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
Gene ID - Mouse ENSMUSG00000035439
Gene ID - Rat ENSRNOG00000052038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAUS8 pAb (ATL-HPA039406)
Datasheet Anti HAUS8 pAb (ATL-HPA039406) Datasheet (External Link)
Vendor Page Anti HAUS8 pAb (ATL-HPA039406) at Atlas Antibodies

Documents & Links for Anti HAUS8 pAb (ATL-HPA039406)
Datasheet Anti HAUS8 pAb (ATL-HPA039406) Datasheet (External Link)
Vendor Page Anti HAUS8 pAb (ATL-HPA039406)