Anti HAUS8 pAb (ATL-HPA039406)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039406-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HAUS8
Alternative Gene Name: HICE1, MGC20533, NY-SAR-48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035439: 47%, ENSRNOG00000052038: 47%
Entrez Gene ID: 93323
Uniprot ID: Q9BT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS |
Gene Sequence | ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS |
Gene ID - Mouse | ENSMUSG00000035439 |
Gene ID - Rat | ENSRNOG00000052038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HAUS8 pAb (ATL-HPA039406) | |
Datasheet | Anti HAUS8 pAb (ATL-HPA039406) Datasheet (External Link) |
Vendor Page | Anti HAUS8 pAb (ATL-HPA039406) at Atlas Antibodies |
Documents & Links for Anti HAUS8 pAb (ATL-HPA039406) | |
Datasheet | Anti HAUS8 pAb (ATL-HPA039406) Datasheet (External Link) |
Vendor Page | Anti HAUS8 pAb (ATL-HPA039406) |