Anti HAUS6 pAb (ATL-HPA020960)

Atlas Antibodies

SKU:
ATL-HPA020960-25
  • Immunohistochemical staining of human esophagus shows strong positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HAUS augmin-like complex, subunit 6
Gene Name: HAUS6
Alternative Gene Name: dgt6, FAM29A, FLJ20060, KIAA1574
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038047: 76%, ENSRNOG00000046028: 72%
Entrez Gene ID: 54801
Uniprot ID: Q7Z4H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVN
Gene Sequence HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVN
Gene ID - Mouse ENSMUSG00000038047
Gene ID - Rat ENSRNOG00000046028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HAUS6 pAb (ATL-HPA020960)
Datasheet Anti HAUS6 pAb (ATL-HPA020960) Datasheet (External Link)
Vendor Page Anti HAUS6 pAb (ATL-HPA020960) at Atlas Antibodies

Documents & Links for Anti HAUS6 pAb (ATL-HPA020960)
Datasheet Anti HAUS6 pAb (ATL-HPA020960) Datasheet (External Link)
Vendor Page Anti HAUS6 pAb (ATL-HPA020960)