Anti HAUS3 pAb (ATL-HPA048190)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048190-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HAUS3
Alternative Gene Name: C4orf15, dgt3, IT1, MGC4701
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079555: 85%, ENSRNOG00000015255: 82%
Entrez Gene ID: 79441
Uniprot ID: Q68CZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLK |
Gene Sequence | MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLK |
Gene ID - Mouse | ENSMUSG00000079555 |
Gene ID - Rat | ENSRNOG00000015255 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HAUS3 pAb (ATL-HPA048190) | |
Datasheet | Anti HAUS3 pAb (ATL-HPA048190) Datasheet (External Link) |
Vendor Page | Anti HAUS3 pAb (ATL-HPA048190) at Atlas Antibodies |
Documents & Links for Anti HAUS3 pAb (ATL-HPA048190) | |
Datasheet | Anti HAUS3 pAb (ATL-HPA048190) Datasheet (External Link) |
Vendor Page | Anti HAUS3 pAb (ATL-HPA048190) |