Anti HAT1 pAb (ATL-HPA036788 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036788-25

• 
• 
• 

Protein Description: histone acetyltransferase 1
Gene Name: HAT1
Alternative Gene Name: KAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027018: 96%, ENSRNOG00000001524: 96%
Entrez Gene ID: 8520
Uniprot ID: O14929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLA
• Gene Sequence: KFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLA
• Gene ID - Mouse: ENSMUSG00000027018
• Gene ID - Rat: ENSRNOG00000001524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.