Anti HAPLN3 pAb (ATL-HPA039237)

Atlas Antibodies

Catalog No.:
ATL-HPA039237-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hyaluronan and proteoglycan link protein 3
Gene Name: HAPLN3
Alternative Gene Name: EXLD1, HsT19883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030606: 76%, ENSRNOG00000022321: 74%
Entrez Gene ID: 145864
Uniprot ID: Q96S86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
Gene Sequence GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
Gene ID - Mouse ENSMUSG00000030606
Gene ID - Rat ENSRNOG00000022321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAPLN3 pAb (ATL-HPA039237)
Datasheet Anti HAPLN3 pAb (ATL-HPA039237) Datasheet (External Link)
Vendor Page Anti HAPLN3 pAb (ATL-HPA039237) at Atlas Antibodies

Documents & Links for Anti HAPLN3 pAb (ATL-HPA039237)
Datasheet Anti HAPLN3 pAb (ATL-HPA039237) Datasheet (External Link)
Vendor Page Anti HAPLN3 pAb (ATL-HPA039237)