Anti HAPLN3 pAb (ATL-HPA039237)

Atlas Antibodies

Catalog No.: ATL-HPA039237-25

Protein Description: hyaluronan and proteoglycan link protein 3
Gene Name: HAPLN3
Alternative Gene Name: EXLD1, HsT19883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030606: 76%, ENSRNOG00000022321: 74%
Entrez Gene ID: 145864
Uniprot ID: Q96S86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
• Gene Sequence: GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
• Gene ID - Mouse: ENSMUSG00000030606
• Gene ID - Rat: ENSRNOG00000022321
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.