Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019482-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hyaluronan and proteoglycan link protein 1
Gene Name: HAPLN1
Alternative Gene Name: CRTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021613: 96%, ENSRNOG00000032002: 94%
Entrez Gene ID: 1404
Uniprot ID: P10915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVA
Gene Sequence KLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVA
Gene ID - Mouse ENSMUSG00000021613
Gene ID - Rat ENSRNOG00000032002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation)
Datasheet Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation)
Datasheet Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation)
Citations for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) – 1 Found
Huynh, Mailee; Pak, Chorom; Markovina, Stephanie; Callander, Natalie S; Chng, Kenneth S; Wuerzberger-Davis, Shelly M; Bakshi, Debayan D; Kink, John A; Hematti, Peiman; Hope, Chelsea; Asimakopoulos, Fotis; Rui, Lixin; Miyamoto, Shigeki. Hyaluronan and proteoglycan link protein 1 (HAPLN1) activates bortezomib-resistant NF-κB activity and increases drug resistance in multiple myeloma. The Journal Of Biological Chemistry. 2018;293(7):2452-2465.  PubMed