Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA019482-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HAPLN1
Alternative Gene Name: CRTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021613: 96%, ENSRNOG00000032002: 94%
Entrez Gene ID: 1404
Uniprot ID: P10915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVA |
Gene Sequence | KLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVA |
Gene ID - Mouse | ENSMUSG00000021613 |
Gene ID - Rat | ENSRNOG00000032002 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) | |
Datasheet | Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) | |
Datasheet | Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) |
Citations for Anti HAPLN1 pAb (ATL-HPA019482 w/enhanced validation) – 1 Found |
Huynh, Mailee; Pak, Chorom; Markovina, Stephanie; Callander, Natalie S; Chng, Kenneth S; Wuerzberger-Davis, Shelly M; Bakshi, Debayan D; Kink, John A; Hematti, Peiman; Hope, Chelsea; Asimakopoulos, Fotis; Rui, Lixin; Miyamoto, Shigeki. Hyaluronan and proteoglycan link protein 1 (HAPLN1) activates bortezomib-resistant NF-κB activity and increases drug resistance in multiple myeloma. The Journal Of Biological Chemistry. 2018;293(7):2452-2465. PubMed |