Anti HAPLN1 pAb (ATL-HPA019105 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019105-25

• 
• 

Protein Description: hyaluronan and proteoglycan link protein 1
Gene Name: HAPLN1
Alternative Gene Name: CRTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021613: 89%, ENSRNOG00000032002: 92%
Entrez Gene ID: 1404
Uniprot ID: P10915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIH
• Gene Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIH
• Gene ID - Mouse: ENSMUSG00000021613
• Gene ID - Rat: ENSRNOG00000032002
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.