Anti HAGH pAb (ATL-HPA043041)
Atlas Antibodies
- SKU:
- ATL-HPA043041-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HAGH
Alternative Gene Name: GLO2, GLXII, HAGH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024158: 92%, ENSRNOG00000014743: 92%
Entrez Gene ID: 3029
Uniprot ID: Q16775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGC |
Gene Sequence | NEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGC |
Gene ID - Mouse | ENSMUSG00000024158 |
Gene ID - Rat | ENSRNOG00000014743 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HAGH pAb (ATL-HPA043041) | |
Datasheet | Anti HAGH pAb (ATL-HPA043041) Datasheet (External Link) |
Vendor Page | Anti HAGH pAb (ATL-HPA043041) at Atlas Antibodies |
Documents & Links for Anti HAGH pAb (ATL-HPA043041) | |
Datasheet | Anti HAGH pAb (ATL-HPA043041) Datasheet (External Link) |
Vendor Page | Anti HAGH pAb (ATL-HPA043041) |