Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA015536-25
  • Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-HADHA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Gene Name: HADHA
Alternative Gene Name: GBP, LCEH, LCHAD, MTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025745: 86%, ENSRNOG00000024629: 85%
Entrez Gene ID: 3030
Uniprot ID: P40939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Gene Sequence IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Gene ID - Mouse ENSMUSG00000025745
Gene ID - Rat ENSRNOG00000024629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)
Datasheet Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)
Datasheet Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)



Citations for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) – 1 Found
Gerin, Isabelle; Clerbaux, Laure-Alix; Haumont, Olivier; Lanthier, Nicolas; Das, Arun K; Burant, Charles F; Leclercq, Isabelle A; MacDougald, Ormond A; Bommer, Guido T. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. The Journal Of Biological Chemistry. 2010;285(44):33652-61.  PubMed
!