Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015536-25

Protein Description: hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Gene Name: HADHA
Alternative Gene Name: GBP, LCEH, LCHAD, MTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025745: 86%, ENSRNOG00000024629: 85%
Entrez Gene ID: 3030
Uniprot ID: P40939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
• Gene Sequence: IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
• Gene ID - Mouse: ENSMUSG00000025745
• Gene ID - Rat: ENSRNOG00000024629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) – 1 Found

Gerin, Isabelle; Clerbaux, Laure-Alix; Haumont, Olivier; Lanthier, Nicolas; Das, Arun K; Burant, Charles F; Leclercq, Isabelle A; MacDougald, Ormond A; Bommer, Guido T. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. The Journal Of Biological Chemistry. 2010;285(44):33652-61.