Anti HADHA pAb (ATL-HPA015536 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015536-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HADHA
Alternative Gene Name: GBP, LCEH, LCHAD, MTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025745: 86%, ENSRNOG00000024629: 85%
Entrez Gene ID: 3030
Uniprot ID: P40939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK |
| Gene Sequence | IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK |
| Gene ID - Mouse | ENSMUSG00000025745 |
| Gene ID - Rat | ENSRNOG00000024629 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) | |
| Datasheet | Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) | |
| Datasheet | Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) |
| Citations for Anti HADHA pAb (ATL-HPA015536 w/enhanced validation) – 1 Found |
| Gerin, Isabelle; Clerbaux, Laure-Alix; Haumont, Olivier; Lanthier, Nicolas; Das, Arun K; Burant, Charles F; Leclercq, Isabelle A; MacDougald, Ormond A; Bommer, Guido T. Expression of miR-33 from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation. The Journal Of Biological Chemistry. 2010;285(44):33652-61. PubMed |