Anti HADH pAb (ATL-HPA039588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039588-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HADH
Alternative Gene Name: HADH1, HADHSC, SCHAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027984: 86%, ENSRNOG00000010697: 88%
Entrez Gene ID: 3033
Uniprot ID: Q16836
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY |
Gene Sequence | YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY |
Gene ID - Mouse | ENSMUSG00000027984 |
Gene ID - Rat | ENSRNOG00000010697 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HADH pAb (ATL-HPA039588) | |
Datasheet | Anti HADH pAb (ATL-HPA039588) Datasheet (External Link) |
Vendor Page | Anti HADH pAb (ATL-HPA039588) at Atlas Antibodies |
Documents & Links for Anti HADH pAb (ATL-HPA039588) | |
Datasheet | Anti HADH pAb (ATL-HPA039588) Datasheet (External Link) |
Vendor Page | Anti HADH pAb (ATL-HPA039588) |