Anti HADH pAb (ATL-HPA039588)

Atlas Antibodies

Catalog No.:
ATL-HPA039588-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hydroxyacyl-CoA dehydrogenase
Gene Name: HADH
Alternative Gene Name: HADH1, HADHSC, SCHAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027984: 86%, ENSRNOG00000010697: 88%
Entrez Gene ID: 3033
Uniprot ID: Q16836
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY
Gene Sequence YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY
Gene ID - Mouse ENSMUSG00000027984
Gene ID - Rat ENSRNOG00000010697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HADH pAb (ATL-HPA039588)
Datasheet Anti HADH pAb (ATL-HPA039588) Datasheet (External Link)
Vendor Page Anti HADH pAb (ATL-HPA039588) at Atlas Antibodies

Documents & Links for Anti HADH pAb (ATL-HPA039588)
Datasheet Anti HADH pAb (ATL-HPA039588) Datasheet (External Link)
Vendor Page Anti HADH pAb (ATL-HPA039588)