Anti HACL1 pAb (ATL-HPA035496)

Atlas Antibodies

SKU:
ATL-HPA035496-25
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 2-hydroxyacyl-CoA lyase 1
Gene Name: HACL1
Alternative Gene Name: 2-HPCL, HPCL, PHYH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021884: 90%, ENSRNOG00000019630: 87%
Entrez Gene ID: 26061
Uniprot ID: Q9UJ83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen CVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQ
Gene Sequence CVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQ
Gene ID - Mouse ENSMUSG00000021884
Gene ID - Rat ENSRNOG00000019630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HACL1 pAb (ATL-HPA035496)
Datasheet Anti HACL1 pAb (ATL-HPA035496) Datasheet (External Link)
Vendor Page Anti HACL1 pAb (ATL-HPA035496) at Atlas Antibodies

Documents & Links for Anti HACL1 pAb (ATL-HPA035496)
Datasheet Anti HACL1 pAb (ATL-HPA035496) Datasheet (External Link)
Vendor Page Anti HACL1 pAb (ATL-HPA035496)



Citations for Anti HACL1 pAb (ATL-HPA035496) – 1 Found
Weitkunat, Karolin; Bishop, Christopher A; Wittmüss, Maria; Machate, Tina; Schifelbein, Tina; Schulze, Matthias B; Klaus, Susanne. Effect of Microbial Status on Hepatic Odd-Chain Fatty Acids Is Diet-Dependent. Nutrients. 2021;13(5)  PubMed