Anti HACE1 pAb (ATL-HPA046071)

Atlas Antibodies

Catalog No.:
ATL-HPA046071-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
Gene Name: HACE1
Alternative Gene Name: KIAA1320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038822: 97%, ENSRNOG00000000327: 97%
Entrez Gene ID: 57531
Uniprot ID: Q8IYU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT
Gene Sequence PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT
Gene ID - Mouse ENSMUSG00000038822
Gene ID - Rat ENSRNOG00000000327
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HACE1 pAb (ATL-HPA046071)
Datasheet Anti HACE1 pAb (ATL-HPA046071) Datasheet (External Link)
Vendor Page Anti HACE1 pAb (ATL-HPA046071) at Atlas Antibodies

Documents & Links for Anti HACE1 pAb (ATL-HPA046071)
Datasheet Anti HACE1 pAb (ATL-HPA046071) Datasheet (External Link)
Vendor Page Anti HACE1 pAb (ATL-HPA046071)