Anti H1FX pAb (ATL-HPA040099)

Atlas Antibodies

Catalog No.:
ATL-HPA040099-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: H1 histone family, member X
Gene Name: H1FX
Alternative Gene Name: H1X, MGC15959, MGC8350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044927: 74%, ENSRNOG00000027722: 73%
Entrez Gene ID: 8971
Uniprot ID: Q92522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG
Gene Sequence ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG
Gene ID - Mouse ENSMUSG00000044927
Gene ID - Rat ENSRNOG00000027722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti H1FX pAb (ATL-HPA040099)
Datasheet Anti H1FX pAb (ATL-HPA040099) Datasheet (External Link)
Vendor Page Anti H1FX pAb (ATL-HPA040099) at Atlas Antibodies

Documents & Links for Anti H1FX pAb (ATL-HPA040099)
Datasheet Anti H1FX pAb (ATL-HPA040099) Datasheet (External Link)
Vendor Page Anti H1FX pAb (ATL-HPA040099)