Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037992-100
  • Immunohistochemistry analysis in human testis and tonsil tissues using HPA037992 antibody. Corresponding H1FOO RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and H1FOO over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406918).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: H1 histone family, member O, oocyte-specific
Gene Name: H1FOO
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052565: 33%, ENSRNOG00000025251: 36%
Entrez Gene ID: 132243
Uniprot ID: Q8IZA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
Gene Sequence YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
Gene ID - Mouse ENSMUSG00000052565
Gene ID - Rat ENSRNOG00000025251
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation)
Datasheet Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation)
Datasheet Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation)