Anti H1FOO pAb (ATL-HPA037992 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037992-100

Protein Description: H1 histone family, member O, oocyte-specific
Gene Name: H1FOO
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052565: 33%, ENSRNOG00000025251: 36%
Entrez Gene ID: 132243
Uniprot ID: Q8IZA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
• Gene Sequence: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
• Gene ID - Mouse: ENSMUSG00000052565
• Gene ID - Rat: ENSRNOG00000025251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.