Anti GZMK pAb (ATL-HPA065895 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065895-25
  • Immunohistochemistry analysis in human lymph node and duodenum tissues using Anti-GZMK antibody. Corresponding GZMK RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: granzyme K
Gene Name: GZMK
Alternative Gene Name: PRSS, TRYP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042385: 68%, ENSRNOG00000010661: 66%
Entrez Gene ID: 3003
Uniprot ID: P49863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
Gene Sequence LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
Gene ID - Mouse ENSMUSG00000042385
Gene ID - Rat ENSRNOG00000010661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GZMK pAb (ATL-HPA065895 w/enhanced validation)
Datasheet Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GZMK pAb (ATL-HPA065895 w/enhanced validation)
Datasheet Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GZMK pAb (ATL-HPA065895 w/enhanced validation)