Anti GZMK pAb (ATL-HPA065895 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA065895-25

Protein Description: granzyme K
Gene Name: GZMK
Alternative Gene Name: PRSS, TRYP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042385: 68%, ENSRNOG00000010661: 66%
Entrez Gene ID: 3003
Uniprot ID: P49863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
• Gene Sequence: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
• Gene ID - Mouse: ENSMUSG00000042385
• Gene ID - Rat: ENSRNOG00000010661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.