Anti GZMA pAb (ATL-HPA054134)

Atlas Antibodies

Catalog No.: ATL-HPA054134-25

Protein Description: granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
Gene Name: GZMA
Alternative Gene Name: CTLA3, HFSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023132: 71%, ENSRNOG00000010603: 76%
Entrez Gene ID: 3001
Uniprot ID: P12544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGG
• Gene Sequence: GRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGG
• Gene ID - Mouse: ENSMUSG00000023132
• Gene ID - Rat: ENSRNOG00000010603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GZMA pAb (ATL-HPA054134) – 1 Found

Roufas, Constantinos; Chasiotis, Dimitrios; Makris, Anestis; Efstathiades, Christodoulos; Dimopoulos, Christos; Zaravinos, Apostolos. The Expression and Prognostic Impact of Immune Cytolytic Activity-Related Markers in Human Malignancies: A Comprehensive Meta-analysis. Frontiers In Oncology. 8( 29515971):27.