Anti GYS2 pAb (ATL-HPA039482)

Atlas Antibodies

Catalog No.:
ATL-HPA039482-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycogen synthase 2 (liver)
Gene Name: GYS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030244: 89%, ENSRNOG00000059753: 89%
Entrez Gene ID: 2998
Uniprot ID: P54840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
Gene Sequence VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
Gene ID - Mouse ENSMUSG00000030244
Gene ID - Rat ENSRNOG00000059753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GYS2 pAb (ATL-HPA039482)
Datasheet Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link)
Vendor Page Anti GYS2 pAb (ATL-HPA039482) at Atlas Antibodies

Documents & Links for Anti GYS2 pAb (ATL-HPA039482)
Datasheet Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link)
Vendor Page Anti GYS2 pAb (ATL-HPA039482)
Citations for Anti GYS2 pAb (ATL-HPA039482) – 1 Found
Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22.  PubMed