Anti GYS2 pAb (ATL-HPA039482)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039482-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GYS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030244: 89%, ENSRNOG00000059753: 89%
Entrez Gene ID: 2998
Uniprot ID: P54840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
Gene Sequence | VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
Gene ID - Mouse | ENSMUSG00000030244 |
Gene ID - Rat | ENSRNOG00000059753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GYS2 pAb (ATL-HPA039482) | |
Datasheet | Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link) |
Vendor Page | Anti GYS2 pAb (ATL-HPA039482) at Atlas Antibodies |
Documents & Links for Anti GYS2 pAb (ATL-HPA039482) | |
Datasheet | Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link) |
Vendor Page | Anti GYS2 pAb (ATL-HPA039482) |
Citations for Anti GYS2 pAb (ATL-HPA039482) – 1 Found |
Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |