Anti GYS2 pAb (ATL-HPA039482)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039482-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GYS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030244: 89%, ENSRNOG00000059753: 89%
Entrez Gene ID: 2998
Uniprot ID: P54840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
| Gene Sequence | VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN |
| Gene ID - Mouse | ENSMUSG00000030244 |
| Gene ID - Rat | ENSRNOG00000059753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GYS2 pAb (ATL-HPA039482) | |
| Datasheet | Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link) |
| Vendor Page | Anti GYS2 pAb (ATL-HPA039482) at Atlas Antibodies |
| Documents & Links for Anti GYS2 pAb (ATL-HPA039482) | |
| Datasheet | Anti GYS2 pAb (ATL-HPA039482) Datasheet (External Link) |
| Vendor Page | Anti GYS2 pAb (ATL-HPA039482) |
| Citations for Anti GYS2 pAb (ATL-HPA039482) – 1 Found |
| Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |