Anti GYS1 pAb (ATL-HPA041598)

Atlas Antibodies

Catalog No.: ATL-HPA041598-25

Protein Description: glycogen synthase 1 (muscle)
Gene Name: GYS1
Alternative Gene Name: GSY, GYS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003865: 86%, ENSRNOG00000020812: 86%
Entrez Gene ID: 2997
Uniprot ID: P13807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE
• Gene Sequence: PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE
• Gene ID - Mouse: ENSMUSG00000003865
• Gene ID - Rat: ENSRNOG00000020812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.