Anti GYS1 pAb (ATL-HPA041598)
Atlas Antibodies
- SKU:
- ATL-HPA041598-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GYS1
Alternative Gene Name: GSY, GYS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003865: 86%, ENSRNOG00000020812: 86%
Entrez Gene ID: 2997
Uniprot ID: P13807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE |
Gene Sequence | PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE |
Gene ID - Mouse | ENSMUSG00000003865 |
Gene ID - Rat | ENSRNOG00000020812 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GYS1 pAb (ATL-HPA041598) | |
Datasheet | Anti GYS1 pAb (ATL-HPA041598) Datasheet (External Link) |
Vendor Page | Anti GYS1 pAb (ATL-HPA041598) at Atlas Antibodies |
Documents & Links for Anti GYS1 pAb (ATL-HPA041598) | |
Datasheet | Anti GYS1 pAb (ATL-HPA041598) Datasheet (External Link) |
Vendor Page | Anti GYS1 pAb (ATL-HPA041598) |