Anti GYPA pAb (ATL-HPA014811)
Atlas Antibodies
- SKU:
- ATL-HPA014811-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GYPA
Alternative Gene Name: CD235a, GPA, MN, MNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047123: 30%, ENSRNOG00000013673: 28%
Entrez Gene ID: 2993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
Gene Sequence | TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
Gene ID - Mouse | ENSMUSG00000047123 |
Gene ID - Rat | ENSRNOG00000013673 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GYPA pAb (ATL-HPA014811) | |
Datasheet | Anti GYPA pAb (ATL-HPA014811) Datasheet (External Link) |
Vendor Page | Anti GYPA pAb (ATL-HPA014811) at Atlas Antibodies |
Documents & Links for Anti GYPA pAb (ATL-HPA014811) | |
Datasheet | Anti GYPA pAb (ATL-HPA014811) Datasheet (External Link) |
Vendor Page | Anti GYPA pAb (ATL-HPA014811) |