Anti GYPA pAb (ATL-HPA014811)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014811-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GYPA
Alternative Gene Name: CD235a, GPA, MN, MNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047123: 30%, ENSRNOG00000013673: 28%
Entrez Gene ID: 2993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
| Gene Sequence | TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
| Gene ID - Mouse | ENSMUSG00000047123 |
| Gene ID - Rat | ENSRNOG00000013673 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GYPA pAb (ATL-HPA014811) | |
| Datasheet | Anti GYPA pAb (ATL-HPA014811) Datasheet (External Link) |
| Vendor Page | Anti GYPA pAb (ATL-HPA014811) at Atlas Antibodies |
| Documents & Links for Anti GYPA pAb (ATL-HPA014811) | |
| Datasheet | Anti GYPA pAb (ATL-HPA014811) Datasheet (External Link) |
| Vendor Page | Anti GYPA pAb (ATL-HPA014811) |