Anti GYPA pAb (ATL-HPA014811)

Atlas Antibodies

SKU: ATL-HPA014811-25

• 

Protein Description: glycophorin A (MNS blood group)
Gene Name: GYPA
Alternative Gene Name: CD235a, GPA, MN, MNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047123: 30%, ENSRNOG00000013673: 28%
Entrez Gene ID: 2993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
• Gene Sequence: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
• Gene ID - Mouse: ENSMUSG00000047123
• Gene ID - Rat: ENSRNOG00000013673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.