Anti GYG1 pAb (ATL-HPA030497)

Atlas Antibodies

SKU:
ATL-HPA030497-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis in human testis tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycogenin 1
Gene Name: GYG1
Alternative Gene Name: GYG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 75%, ENSRNOG00000011146: 75%
Entrez Gene ID: 2992
Uniprot ID: P46976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYL
Gene Sequence FLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYL
Gene ID - Mouse ENSMUSG00000019528
Gene ID - Rat ENSRNOG00000011146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GYG1 pAb (ATL-HPA030497)
Datasheet Anti GYG1 pAb (ATL-HPA030497) Datasheet (External Link)
Vendor Page Anti GYG1 pAb (ATL-HPA030497) at Atlas Antibodies

Documents & Links for Anti GYG1 pAb (ATL-HPA030497)
Datasheet Anti GYG1 pAb (ATL-HPA030497) Datasheet (External Link)
Vendor Page Anti GYG1 pAb (ATL-HPA030497)