Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020587-25

Protein Description: GULP, engulfment adaptor PTB domain containing 1
Gene Name: GULP1
Alternative Gene Name: CED-6, CED6, GULP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056870: 94%, ENSRNOG00000003242: 95%
Entrez Gene ID: 51454
Uniprot ID: Q9UBP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
• Gene Sequence: KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
• Gene ID - Mouse: ENSMUSG00000056870
• Gene ID - Rat: ENSRNOG00000003242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) – 1 Found

Gong, Jingyi; Gaitanos, Thomas N; Luu, Olivia; Huang, Yunyun; Gaitanos, Louise; Lindner, Jana; Winklbauer, Rudolf; Klein, Rüdiger. Gulp1 controls Eph/ephrin trogocytosis and is important for cell rearrangements during development. The Journal Of Cell Biology. 2019;218(10):3455-3471.