Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA020587-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GULP, engulfment adaptor PTB domain containing 1
Gene Name: GULP1
Alternative Gene Name: CED-6, CED6, GULP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056870: 94%, ENSRNOG00000003242: 95%
Entrez Gene ID: 51454
Uniprot ID: Q9UBP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
Gene Sequence KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
Gene ID - Mouse ENSMUSG00000056870
Gene ID - Rat ENSRNOG00000003242
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation)
Datasheet Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation)
Datasheet Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation)
Citations for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) – 1 Found
Gong, Jingyi; Gaitanos, Thomas N; Luu, Olivia; Huang, Yunyun; Gaitanos, Louise; Lindner, Jana; Winklbauer, Rudolf; Klein, Rüdiger. Gulp1 controls Eph/ephrin trogocytosis and is important for cell rearrangements during development. The Journal Of Cell Biology. 2019;218(10):3455-3471.  PubMed