Anti GUCY2C pAb (ATL-HPA037655)

Atlas Antibodies

Catalog No.:
ATL-HPA037655-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanylate cyclase 2C (heat stable enterotoxin receptor)
Gene Name: GUCY2C
Alternative Gene Name: GUC2C, STAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042638: 79%, ENSRNOG00000009031: 80%
Entrez Gene ID: 2984
Uniprot ID: P25092
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Gene Sequence EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Gene ID - Mouse ENSMUSG00000042638
Gene ID - Rat ENSRNOG00000009031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GUCY2C pAb (ATL-HPA037655)
Datasheet Anti GUCY2C pAb (ATL-HPA037655) Datasheet (External Link)
Vendor Page Anti GUCY2C pAb (ATL-HPA037655) at Atlas Antibodies

Documents & Links for Anti GUCY2C pAb (ATL-HPA037655)
Datasheet Anti GUCY2C pAb (ATL-HPA037655) Datasheet (External Link)
Vendor Page Anti GUCY2C pAb (ATL-HPA037655)
Citations for Anti GUCY2C pAb (ATL-HPA037655) – 2 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Brenna, Øystein; Bruland, Torunn; Furnes, Marianne W; Granlund, Atle van Beelen; Drozdov, Ignat; Emgård, Johanna; Brønstad, Gunnar; Kidd, Mark; Sandvik, Arne K; Gustafsson, Björn I. The guanylate cyclase-C signaling pathway is down-regulated in inflammatory bowel disease. Scandinavian Journal Of Gastroenterology. 50(10):1241-52.  PubMed