Anti GUCY1B3 pAb (ATL-HPA020870)

Atlas Antibodies

Catalog No.:
ATL-HPA020870-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanylate cyclase 1, soluble, beta 3
Gene Name: GUCY1B3
Alternative Gene Name: GC-S-beta-1, GC-SB3, GUC1B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028005: 100%, ENSRNOG00000012060: 100%
Entrez Gene ID: 2983
Uniprot ID: Q02153
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Gene Sequence HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Gene ID - Mouse ENSMUSG00000028005
Gene ID - Rat ENSRNOG00000012060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GUCY1B3 pAb (ATL-HPA020870)
Datasheet Anti GUCY1B3 pAb (ATL-HPA020870) Datasheet (External Link)
Vendor Page Anti GUCY1B3 pAb (ATL-HPA020870) at Atlas Antibodies

Documents & Links for Anti GUCY1B3 pAb (ATL-HPA020870)
Datasheet Anti GUCY1B3 pAb (ATL-HPA020870) Datasheet (External Link)
Vendor Page Anti GUCY1B3 pAb (ATL-HPA020870)