Anti GUCA2A pAb (ATL-HPA018215 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018215-25

• 
• 

Protein Description: guanylate cyclase activator 2A (guanylin)
Gene Name: GUCA2A
Alternative Gene Name: GUCA2, STARA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023247: 65%, ENSRNOG00000008849: 64%
Entrez Gene ID: 2980
Uniprot ID: Q02747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
• Gene Sequence: SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
• Gene ID - Mouse: ENSMUSG00000023247
• Gene ID - Rat: ENSRNOG00000008849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GUCA2A pAb (ATL-HPA018215 w/enhanced validation) – 6 Found

Brenna, Øystein; Furnes, Marianne W; Munkvold, Bjørn; Kidd, Mark; Sandvik, Arne K; Gustafsson, Björn I. Cellular localization of guanylin and uroguanylin mRNAs in human and rat duodenal and colonic mucosa. Cell And Tissue Research. 2016;365(2):331-41. 

Rappaport, Jeffrey A; Entezari, Ariana A; Caspi, Adi; Caksa, Signe; Jhaveri, Aakash V; Stanek, Timothy J; Ertel, Adam; Kupper, Joan; Fortina, Paolo M; McMahon, Steven B; Jaynes, James B; Snook, Adam E; Waldman, Scott A. A β-Catenin-TCF-Sensitive Locus Control Region Mediates GUCY2C Ligand Loss in Colorectal Cancer. Cellular And Molecular Gastroenterology And Hepatology. 13(4):1276-1296. 

Wilson, Chantell; Lin, Jieru E; Li, Peng; Snook, Adam E; Gong, Jianping; Sato, Takahiro; Liu, Chengbao; Girondo, Melanie A; Rui, Hallgeir; Hyslop, Terry; Waldman, Scott A. The paracrine hormone for the GUCY2C tumor suppressor, guanylin, is universally lost in colorectal cancer. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2014;23(11):2328-37. 

Brenna, Øystein; Bruland, Torunn; Furnes, Marianne W; Granlund, Atle van Beelen; Drozdov, Ignat; Emgård, Johanna; Brønstad, Gunnar; Kidd, Mark; Sandvik, Arne K; Gustafsson, Björn I. The guanylate cyclase-C signaling pathway is down-regulated in inflammatory bowel disease. Scandinavian Journal Of Gastroenterology. 50(10):1241-52. 

Blomain, Erik S; Rappaport, Jeffrey A; Pattison, Amanda M; Bashir, Babar; Caparosa, Ellen; Stem, Jonathan; Snook, Adam E; Waldman, Scott A. APC-β-catenin-TCF signaling silences the intestinal guanylin-GUCY2C tumor suppressor axis. Cancer Biology & Therapy. 2020;21(5):441-451. 

Pattison, Amanda M; Barton, Joshua R; Entezari, Ariana A; Zalewski, Alicja; Rappaport, Jeff A; Snook, Adam E; Waldman, Scott A. Silencing the intestinal GUCY2C tumor suppressor axis requires APC loss of heterozygosity. Cancer Biology & Therapy. 2020;21(9):799-805.