Anti GTPBP6 pAb (ATL-HPA035467)
Atlas Antibodies
- SKU:
- ATL-HPA035467-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GTPBP6
Alternative Gene Name: FLJ20977, PGPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033434: 64%, ENSRNOG00000048168: 61%
Entrez Gene ID: 8225
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVSALRGHGLQEL |
Gene Sequence | DLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVSALRGHGLQEL |
Gene ID - Mouse | ENSMUSG00000033434 |
Gene ID - Rat | ENSRNOG00000048168 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTPBP6 pAb (ATL-HPA035467) | |
Datasheet | Anti GTPBP6 pAb (ATL-HPA035467) Datasheet (External Link) |
Vendor Page | Anti GTPBP6 pAb (ATL-HPA035467) at Atlas Antibodies |
Documents & Links for Anti GTPBP6 pAb (ATL-HPA035467) | |
Datasheet | Anti GTPBP6 pAb (ATL-HPA035467) Datasheet (External Link) |
Vendor Page | Anti GTPBP6 pAb (ATL-HPA035467) |