Anti GTPBP6 pAb (ATL-HPA013336)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013336-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GTPBP6
Alternative Gene Name: FLJ20977, PGPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033434: 72%, ENSRNOG00000048168: 71%
Entrez Gene ID: 8225
Uniprot ID: O43824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS |
Gene Sequence | PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS |
Gene ID - Mouse | ENSMUSG00000033434 |
Gene ID - Rat | ENSRNOG00000048168 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336) | |
Datasheet | Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link) |
Vendor Page | Anti GTPBP6 pAb (ATL-HPA013336) at Atlas Antibodies |
Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336) | |
Datasheet | Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link) |
Vendor Page | Anti GTPBP6 pAb (ATL-HPA013336) |