Anti GTPBP6 pAb (ATL-HPA013336)

Atlas Antibodies

Catalog No.:
ATL-HPA013336-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GTP binding protein 6 (putative)
Gene Name: GTPBP6
Alternative Gene Name: FLJ20977, PGPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033434: 72%, ENSRNOG00000048168: 71%
Entrez Gene ID: 8225
Uniprot ID: O43824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS
Gene Sequence PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS
Gene ID - Mouse ENSMUSG00000033434
Gene ID - Rat ENSRNOG00000048168
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336)
Datasheet Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link)
Vendor Page Anti GTPBP6 pAb (ATL-HPA013336) at Atlas Antibodies

Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336)
Datasheet Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link)
Vendor Page Anti GTPBP6 pAb (ATL-HPA013336)