Anti GTPBP6 pAb (ATL-HPA013336)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013336-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GTPBP6
Alternative Gene Name: FLJ20977, PGPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033434: 72%, ENSRNOG00000048168: 71%
Entrez Gene ID: 8225
Uniprot ID: O43824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS |
| Gene Sequence | PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS |
| Gene ID - Mouse | ENSMUSG00000033434 |
| Gene ID - Rat | ENSRNOG00000048168 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336) | |
| Datasheet | Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link) |
| Vendor Page | Anti GTPBP6 pAb (ATL-HPA013336) at Atlas Antibodies |
| Documents & Links for Anti GTPBP6 pAb (ATL-HPA013336) | |
| Datasheet | Anti GTPBP6 pAb (ATL-HPA013336) Datasheet (External Link) |
| Vendor Page | Anti GTPBP6 pAb (ATL-HPA013336) |