Anti GTPBP6 pAb (ATL-HPA013336)

Atlas Antibodies

Catalog No.: ATL-HPA013336-25

Protein Description: GTP binding protein 6 (putative)
Gene Name: GTPBP6
Alternative Gene Name: FLJ20977, PGPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033434: 72%, ENSRNOG00000048168: 71%
Entrez Gene ID: 8225
Uniprot ID: O43824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS
• Gene Sequence: PRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKVDLVPGYSPTEPNVVPVS
• Gene ID - Mouse: ENSMUSG00000033434
• Gene ID - Rat: ENSRNOG00000048168
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.