Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039618-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GTP binding protein 4
Gene Name: GTPBP4
Alternative Gene Name: CRFG, FLJ10686, FLJ10690, NGB, NOG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021149: 93%, ENSRNOG00000016217: 93%
Entrez Gene ID: 23560
Uniprot ID: Q9BZE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPT
Gene Sequence PLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPT
Gene ID - Mouse ENSMUSG00000021149
Gene ID - Rat ENSRNOG00000016217
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation)
Datasheet Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation)
Datasheet Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTPBP4 pAb (ATL-HPA039618 w/enhanced validation)