Anti GTPBP3 pAb (ATL-HPA042158)

Atlas Antibodies

Catalog No.:
ATL-HPA042158-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GTP binding protein 3 (mitochondrial)
Gene Name: GTPBP3
Alternative Gene Name: FLJ14700, GTPBG3, MSS1, MTGP1, THDF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007610: 84%, ENSRNOG00000023403: 82%
Entrez Gene ID: 84705
Uniprot ID: Q969Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL
Gene Sequence HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL
Gene ID - Mouse ENSMUSG00000007610
Gene ID - Rat ENSRNOG00000023403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GTPBP3 pAb (ATL-HPA042158)
Datasheet Anti GTPBP3 pAb (ATL-HPA042158) Datasheet (External Link)
Vendor Page Anti GTPBP3 pAb (ATL-HPA042158) at Atlas Antibodies

Documents & Links for Anti GTPBP3 pAb (ATL-HPA042158)
Datasheet Anti GTPBP3 pAb (ATL-HPA042158) Datasheet (External Link)
Vendor Page Anti GTPBP3 pAb (ATL-HPA042158)
Citations for Anti GTPBP3 pAb (ATL-HPA042158) – 2 Found
Chen, Danni; Zhang, Zengming; Chen, Chao; Yao, Shihao; Yang, Qingxian; Li, Feng; He, Xiao; Ai, Cheng; Wang, Meng; Guan, Min-Xin. Deletion of Gtpbp3 in zebrafish revealed the hypertrophic cardiomyopathy manifested by aberrant mitochondrial tRNA metabolism. Nucleic Acids Research. 2019;47(10):5341-5355.  PubMed
Kopajtich, Robert; Nicholls, Thomas J; Rorbach, Joanna; Metodiev, Metodi D; Freisinger, Peter; Mandel, Hanna; Vanlander, Arnaud; Ghezzi, Daniele; Carrozzo, Rosalba; Taylor, Robert W; Marquard, Klaus; Murayama, Kei; Wieland, Thomas; Schwarzmayr, Thomas; Mayr, Johannes A; Pearce, Sarah F; Powell, Christopher A; Saada, Ann; Ohtake, Akira; Invernizzi, Federica; Lamantea, Eleonora; Sommerville, Ewen W; Pyle, Angela; Chinnery, Patrick F; Crushell, Ellen; Okazaki, Yasushi; Kohda, Masakazu; Kishita, Yoshihito; Tokuzawa, Yoshimi; Assouline, Zahra; Rio, Marlène; Feillet, François; Mousson de Camaret, Bénédict; Chretien, Dominique; Munnich, Arnold; Menten, Björn; Sante, Tom; Smet, Joél; Régal, Luc; Lorber, Abraham; Khoury, Asaad; Zeviani, Massimo; Strom, Tim M; Meitinger, Thomas; Bertini, Enrico S; Van Coster, Rudy; Klopstock, Thomas; Rötig, Agnès; Haack, Tobias B; Minczuk, Michal; Prokisch, Holger. Mutations in GTPBP3 cause a mitochondrial translation defect associated with hypertrophic cardiomyopathy, lactic acidosis, and encephalopathy. American Journal Of Human Genetics. 2014;95(6):708-20.  PubMed