Anti GTPBP3 pAb (ATL-HPA042158)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042158-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GTPBP3
Alternative Gene Name: FLJ14700, GTPBG3, MSS1, MTGP1, THDF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007610: 84%, ENSRNOG00000023403: 82%
Entrez Gene ID: 84705
Uniprot ID: Q969Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL |
| Gene Sequence | HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL |
| Gene ID - Mouse | ENSMUSG00000007610 |
| Gene ID - Rat | ENSRNOG00000023403 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GTPBP3 pAb (ATL-HPA042158) | |
| Datasheet | Anti GTPBP3 pAb (ATL-HPA042158) Datasheet (External Link) |
| Vendor Page | Anti GTPBP3 pAb (ATL-HPA042158) at Atlas Antibodies |
| Documents & Links for Anti GTPBP3 pAb (ATL-HPA042158) | |
| Datasheet | Anti GTPBP3 pAb (ATL-HPA042158) Datasheet (External Link) |
| Vendor Page | Anti GTPBP3 pAb (ATL-HPA042158) |
| Citations for Anti GTPBP3 pAb (ATL-HPA042158) – 2 Found |
| Chen, Danni; Zhang, Zengming; Chen, Chao; Yao, Shihao; Yang, Qingxian; Li, Feng; He, Xiao; Ai, Cheng; Wang, Meng; Guan, Min-Xin. Deletion of Gtpbp3 in zebrafish revealed the hypertrophic cardiomyopathy manifested by aberrant mitochondrial tRNA metabolism. Nucleic Acids Research. 2019;47(10):5341-5355. PubMed |
| Kopajtich, Robert; Nicholls, Thomas J; Rorbach, Joanna; Metodiev, Metodi D; Freisinger, Peter; Mandel, Hanna; Vanlander, Arnaud; Ghezzi, Daniele; Carrozzo, Rosalba; Taylor, Robert W; Marquard, Klaus; Murayama, Kei; Wieland, Thomas; Schwarzmayr, Thomas; Mayr, Johannes A; Pearce, Sarah F; Powell, Christopher A; Saada, Ann; Ohtake, Akira; Invernizzi, Federica; Lamantea, Eleonora; Sommerville, Ewen W; Pyle, Angela; Chinnery, Patrick F; Crushell, Ellen; Okazaki, Yasushi; Kohda, Masakazu; Kishita, Yoshihito; Tokuzawa, Yoshimi; Assouline, Zahra; Rio, Marlène; Feillet, François; Mousson de Camaret, Bénédict; Chretien, Dominique; Munnich, Arnold; Menten, Björn; Sante, Tom; Smet, Joél; Régal, Luc; Lorber, Abraham; Khoury, Asaad; Zeviani, Massimo; Strom, Tim M; Meitinger, Thomas; Bertini, Enrico S; Van Coster, Rudy; Klopstock, Thomas; Rötig, Agnès; Haack, Tobias B; Minczuk, Michal; Prokisch, Holger. Mutations in GTPBP3 cause a mitochondrial translation defect associated with hypertrophic cardiomyopathy, lactic acidosis, and encephalopathy. American Journal Of Human Genetics. 2014;95(6):708-20. PubMed |