Anti GTPBP10 pAb (ATL-HPA021076 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021076-100
  • Immunohistochemical staining of human lymph node shows strong nuclear positivity in a subset of lymphoid cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: GTP-binding protein 10 (putative)
Gene Name: GTPBP10
Alternative Gene Name: DKFZP686A10121, FLJ38242
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040464: 85%, ENSRNOG00000007098: 86%
Entrez Gene ID: 85865
Uniprot ID: A4D1E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Gene Sequence ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Gene ID - Mouse ENSMUSG00000040464
Gene ID - Rat ENSRNOG00000007098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GTPBP10 pAb (ATL-HPA021076 w/enhanced validation)
Datasheet Anti GTPBP10 pAb (ATL-HPA021076 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTPBP10 pAb (ATL-HPA021076 w/enhanced validation)



Citations for Anti GTPBP10 pAb (ATL-HPA021076 w/enhanced validation) – 1 Found
Busch, Jakob D; Cipullo, Miriam; Atanassov, Ilian; Bratic, Ana; Silva Ramos, Eduardo; Schöndorf, Thomas; Li, Xinping; Pearce, Sarah F; Milenkovic, Dusanka; Rorbach, Joanna; Larsson, Nils-Göran. MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition. Cell Reports. 2019;29(6):1728-1738.e9.  PubMed