Anti GTF2IRD1 pAb (ATL-HPA044254)

Atlas Antibodies

SKU:
ATL-HPA044254-25
  • Immunohistochemical staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GTF2I repeat domain containing 1
Gene Name: GTF2IRD1
Alternative Gene Name: BEN, Cream1, GTF3, MusTRD1, RBAP2, WBSCR11, WBSCR12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023079: 86%, ENSRNOG00000001478: 86%
Entrez Gene ID: 9569
Uniprot ID: Q9UHL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD
Gene Sequence RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD
Gene ID - Mouse ENSMUSG00000023079
Gene ID - Rat ENSRNOG00000001478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2IRD1 pAb (ATL-HPA044254)
Datasheet Anti GTF2IRD1 pAb (ATL-HPA044254) Datasheet (External Link)
Vendor Page Anti GTF2IRD1 pAb (ATL-HPA044254) at Atlas Antibodies

Documents & Links for Anti GTF2IRD1 pAb (ATL-HPA044254)
Datasheet Anti GTF2IRD1 pAb (ATL-HPA044254) Datasheet (External Link)
Vendor Page Anti GTF2IRD1 pAb (ATL-HPA044254)