Anti GTF2H3 pAb (ATL-HPA004844)

Atlas Antibodies

SKU:
ATL-HPA004844-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in cells in tubules.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIH, polypeptide 3, 34kDa
Gene Name: GTF2H3
Alternative Gene Name: BTF2, P34, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029387: 90%, ENSRNOG00000001035: 91%
Entrez Gene ID: 2967
Uniprot ID: Q13889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAG
Gene Sequence LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAG
Gene ID - Mouse ENSMUSG00000029387
Gene ID - Rat ENSRNOG00000001035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2H3 pAb (ATL-HPA004844)
Datasheet Anti GTF2H3 pAb (ATL-HPA004844) Datasheet (External Link)
Vendor Page Anti GTF2H3 pAb (ATL-HPA004844) at Atlas Antibodies

Documents & Links for Anti GTF2H3 pAb (ATL-HPA004844)
Datasheet Anti GTF2H3 pAb (ATL-HPA004844) Datasheet (External Link)
Vendor Page Anti GTF2H3 pAb (ATL-HPA004844)