Anti GTF2F1 pAb (ATL-HPA022793 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA022793-25
  • Immunohistochemical staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cell junctions.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GTF2F1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400767).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIF, polypeptide 1, 74kDa
Gene Name: GTF2F1
Alternative Gene Name: BTF4, RAP74, TF2F1, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002658: 98%, ENSRNOG00000047134: 98%
Entrez Gene ID: 2962
Uniprot ID: P35269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Gene Sequence LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Gene ID - Mouse ENSMUSG00000002658
Gene ID - Rat ENSRNOG00000047134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GTF2F1 pAb (ATL-HPA022793 w/enhanced validation)
Datasheet Anti GTF2F1 pAb (ATL-HPA022793 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTF2F1 pAb (ATL-HPA022793 w/enhanced validation)