Anti GTF2A1 pAb (ATL-HPA000869)

Atlas Antibodies

SKU:
ATL-HPA000869-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIA, 1, 19/37kDa
Gene Name: GTF2A1
Alternative Gene Name: TFIIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020962: 95%, ENSRNOG00000004300: 98%
Entrez Gene ID: 2957
Uniprot ID: P52655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQA
Gene Sequence QQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQA
Gene ID - Mouse ENSMUSG00000020962
Gene ID - Rat ENSRNOG00000004300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2A1 pAb (ATL-HPA000869)
Datasheet Anti GTF2A1 pAb (ATL-HPA000869) Datasheet (External Link)
Vendor Page Anti GTF2A1 pAb (ATL-HPA000869) at Atlas Antibodies

Documents & Links for Anti GTF2A1 pAb (ATL-HPA000869)
Datasheet Anti GTF2A1 pAb (ATL-HPA000869) Datasheet (External Link)
Vendor Page Anti GTF2A1 pAb (ATL-HPA000869)