Anti GTDC1 pAb (ATL-HPA036694)

Atlas Antibodies

SKU: ATL-HPA036694-100

• 
• 
• 

Protein Description: glycosyltransferase-like domain containing 1
Gene Name: GTDC1
Alternative Gene Name: FLJ11753, Hmat-Xa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036890: 93%, ENSRNOG00000031038: 93%
Entrez Gene ID: 79712
Uniprot ID: Q4AE62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL
• Gene Sequence: HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL
• Gene ID - Mouse: ENSMUSG00000036890
• Gene ID - Rat: ENSRNOG00000031038
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.