Anti GSR pAb (ATL-HPA001538)

Atlas Antibodies

Catalog No.:
ATL-HPA001538-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glutathione reductase
Gene Name: GSR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031584: 83%, ENSRNOG00000014915: 80%
Entrez Gene ID: 2936
Uniprot ID: P00390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILS
Gene Sequence GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILS
Gene ID - Mouse ENSMUSG00000031584
Gene ID - Rat ENSRNOG00000014915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSR pAb (ATL-HPA001538)
Datasheet Anti GSR pAb (ATL-HPA001538) Datasheet (External Link)
Vendor Page Anti GSR pAb (ATL-HPA001538) at Atlas Antibodies

Documents & Links for Anti GSR pAb (ATL-HPA001538)
Datasheet Anti GSR pAb (ATL-HPA001538) Datasheet (External Link)
Vendor Page Anti GSR pAb (ATL-HPA001538)