Anti GSE1 pAb (ATL-HPA042090)

Atlas Antibodies

Catalog No.:
ATL-HPA042090-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Gse1 coiled-coil protein
Gene Name: GSE1
Alternative Gene Name: KIAA0182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031822: 78%, ENSRNOG00000017489: 55%
Entrez Gene ID: 23199
Uniprot ID: Q14687
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAPGGKKSLSMLHYIRG
Gene Sequence VSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAPGGKKSLSMLHYIRG
Gene ID - Mouse ENSMUSG00000031822
Gene ID - Rat ENSRNOG00000017489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSE1 pAb (ATL-HPA042090)
Datasheet Anti GSE1 pAb (ATL-HPA042090) Datasheet (External Link)
Vendor Page Anti GSE1 pAb (ATL-HPA042090) at Atlas Antibodies

Documents & Links for Anti GSE1 pAb (ATL-HPA042090)
Datasheet Anti GSE1 pAb (ATL-HPA042090) Datasheet (External Link)
Vendor Page Anti GSE1 pAb (ATL-HPA042090)