Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044487-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GSDMD
Alternative Gene Name: DF5L, FLJ12150, GSDMDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022575: 61%, ENSRNOG00000007728: 63%
Entrez Gene ID: 79792
Uniprot ID: P57764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Gene Sequence | GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Gene ID - Mouse | ENSMUSG00000022575 |
| Gene ID - Rat | ENSRNOG00000007728 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) | |
| Datasheet | Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) | |
| Datasheet | Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) |
| Citations for Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) – 5 Found |
| Theobald, Sebastian J; Gräb, Jessica; Fritsch, Melanie; Suárez, Isabelle; Eisfeld, Hannah S; Winter, Sandra; Koch, Maximilian; Hölscher, Christoph; Pasparakis, Manolis; Kashkar, Hamid; Rybniker, Jan. Gasdermin D mediates host cell death but not interleukin-1β secretion in Mycobacterium tuberculosis-infected macrophages. Cell Death Discovery. 2021;7(1):327. PubMed |
| Rathkey, Joseph K; Zhao, Junjie; Liu, Zhonghua; Chen, Yinghua; Yang, Jie; Kondolf, Hannah C; Benson, Bryan L; Chirieleison, Steven M; Huang, Alex Y; Dubyak, George R; Xiao, Tsan S; Li, Xiaoxia; Abbott, Derek W. Chemical disruption of the pyroptotic pore-forming protein gasdermin D inhibits inflammatory cell death and sepsis. Science Immunology. 2018;3(26) PubMed |
| Rathkey, Joseph K; Xiao, Tsan S; Abbott, Derek W. Human polymorphisms in GSDMD alter the inflammatory response. The Journal Of Biological Chemistry. 2020;295(10):3228-3238. PubMed |
| Zhou, Bowen; Abbott, Derek W. Gasdermin E permits interleukin-1 beta release in distinct sublytic and pyroptotic phases. Cell Reports. 2021;35(2):108998. PubMed |
| Kondolf, Hannah C; D'Orlando, Dana A; Dubyak, George R; Abbott, Derek W. Protein engineering reveals that gasdermin A preferentially targets mitochondrial membranes over the plasma membrane during pyroptosis. The Journal Of Biological Chemistry. 2023;299(2):102908. PubMed |