Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044487-25

• 

Protein Description: gasdermin D
Gene Name: GSDMD
Alternative Gene Name: DF5L, FLJ12150, GSDMDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022575: 61%, ENSRNOG00000007728: 63%
Entrez Gene ID: 79792
Uniprot ID: P57764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
• Gene Sequence: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
• Gene ID - Mouse: ENSMUSG00000022575
• Gene ID - Rat: ENSRNOG00000007728
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GSDMD pAb (ATL-HPA044487 w/enhanced validation) – 5 Found

Theobald, Sebastian J; Gräb, Jessica; Fritsch, Melanie; Suárez, Isabelle; Eisfeld, Hannah S; Winter, Sandra; Koch, Maximilian; Hölscher, Christoph; Pasparakis, Manolis; Kashkar, Hamid; Rybniker, Jan. Gasdermin D mediates host cell death but not interleukin-1β secretion in Mycobacterium tuberculosis-infected macrophages. Cell Death Discovery. 2021;7(1):327. 

Rathkey, Joseph K; Zhao, Junjie; Liu, Zhonghua; Chen, Yinghua; Yang, Jie; Kondolf, Hannah C; Benson, Bryan L; Chirieleison, Steven M; Huang, Alex Y; Dubyak, George R; Xiao, Tsan S; Li, Xiaoxia; Abbott, Derek W. Chemical disruption of the pyroptotic pore-forming protein gasdermin D inhibits inflammatory cell death and sepsis. Science Immunology. 2018;3(26) 

Rathkey, Joseph K; Xiao, Tsan S; Abbott, Derek W. Human polymorphisms in GSDMD alter the inflammatory response. The Journal Of Biological Chemistry. 2020;295(10):3228-3238. 

Zhou, Bowen; Abbott, Derek W. Gasdermin E permits interleukin-1 beta release in distinct sublytic and pyroptotic phases. Cell Reports. 2021;35(2):108998. 

Kondolf, Hannah C; D'Orlando, Dana A; Dubyak, George R; Abbott, Derek W. Protein engineering reveals that gasdermin A preferentially targets mitochondrial membranes over the plasma membrane during pyroptosis. The Journal Of Biological Chemistry. 2023;299(2):102908.