Anti GSDMC pAb (ATL-HPA026317)

Atlas Antibodies

SKU:
ATL-HPA026317-25
  • Immunohistochemical staining of human cervix, uterine shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: gasdermin C
Gene Name: GSDMC
Alternative Gene Name: MLZE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079025: 54%, ENSRNOG00000054576: 53%
Entrez Gene ID: 56169
Uniprot ID: Q9BYG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP
Gene Sequence LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP
Gene ID - Mouse ENSMUSG00000079025
Gene ID - Rat ENSRNOG00000054576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GSDMC pAb (ATL-HPA026317)
Datasheet Anti GSDMC pAb (ATL-HPA026317) Datasheet (External Link)
Vendor Page Anti GSDMC pAb (ATL-HPA026317) at Atlas Antibodies

Documents & Links for Anti GSDMC pAb (ATL-HPA026317)
Datasheet Anti GSDMC pAb (ATL-HPA026317) Datasheet (External Link)
Vendor Page Anti GSDMC pAb (ATL-HPA026317)