Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023313-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GSDMA
Alternative Gene Name: FLJ39120, GSDM, GSDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017204: 88%, ENSRNOG00000007943: 85%
Entrez Gene ID: 284110
Uniprot ID: Q96QA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS |
| Gene Sequence | VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS |
| Gene ID - Mouse | ENSMUSG00000017204 |
| Gene ID - Rat | ENSRNOG00000007943 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) | |
| Datasheet | Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) | |
| Datasheet | Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) |
| Citations for Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) – 1 Found |
| Lachner, Julia; Mlitz, Veronika; Tschachler, Erwin; Eckhart, Leopold. Epidermal cornification is preceded by the expression of a keratinocyte-specific set of pyroptosis-related genes. Scientific Reports. 2017;7(1):17446. PubMed |