Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023313-25

• 

Protein Description: gasdermin A
Gene Name: GSDMA
Alternative Gene Name: FLJ39120, GSDM, GSDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017204: 88%, ENSRNOG00000007943: 85%
Entrez Gene ID: 284110
Uniprot ID: Q96QA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
• Gene Sequence: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
• Gene ID - Mouse: ENSMUSG00000017204
• Gene ID - Rat: ENSRNOG00000007943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GSDMA pAb (ATL-HPA023313 w/enhanced validation) – 1 Found

Lachner, Julia; Mlitz, Veronika; Tschachler, Erwin; Eckhart, Leopold. Epidermal cornification is preceded by the expression of a keratinocyte-specific set of pyroptosis-related genes. Scientific Reports. 2017;7(1):17446.