Anti GRXCR1 pAb (ATL-HPA040824)

Atlas Antibodies

Catalog No.: ATL-HPA040824-25

Protein Description: glutaredoxin, cysteine rich 1
Gene Name: GRXCR1
Alternative Gene Name: DFNB25, PPP1R88
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068082: 97%, ENSRNOG00000038891: 97%
Entrez Gene ID: 389207
Uniprot ID: A8MXD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGK
• Gene Sequence: GVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGK
• Gene ID - Mouse: ENSMUSG00000068082
• Gene ID - Rat: ENSRNOG00000038891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.