Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036985-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GRSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044221: 83%, ENSRNOG00000003392: 80%
Entrez Gene ID: 2926
Uniprot ID: Q12849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH |
Gene Sequence | RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH |
Gene ID - Mouse | ENSMUSG00000044221 |
Gene ID - Rat | ENSRNOG00000003392 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) | |
Datasheet | Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) | |
Datasheet | Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) |
Citations for Anti GRSF1 pAb (ATL-HPA036985 w/enhanced validation) – 13 Found |
Antonicka, Hana; Choquet, Karine; Lin, Zhen-Yuan; Gingras, Anne-Claude; Kleinman, Claudia L; Shoubridge, Eric A. A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability. Embo Reports. 2017;18(1):28-38. PubMed |
Kim, Su-Jeong; Chun, Maria; Wan, Junxiang; Lee, Changhan; Yen, Kelvin; Cohen, Pinchas. GRSF1 is an age-related regulator of senescence. Scientific Reports. 2019;9(1):5546. PubMed |
Driscoll, Riley K; Krasniewski, Linda K; Cockey, Samuel G; Yang, Jen-Hao; Piao, Yulan; Lehrmann, Elin; Zhang, Yongqing; Michel, Marc; Noh, Ji Heon; Cui, Chang-Yi; Gorospe, Myriam. GRSF1 deficiency in skeletal muscle reduces endurance in aged mice. Aging. 2021;13(11):14557-14570. PubMed |
Key, Jana; Torres-Odio, Sylvia; Bach, Nina C; Gispert, Suzana; Koepf, Gabriele; Reichlmeir, Marina; West, A Phillip; Prokisch, Holger; Freisinger, Peter; Newman, William G; Shalev, Stavit; Sieber, Stephan A; Wittig, Ilka; Auburger, Georg. Inactivity of Peptidase ClpP Causes Primary Accumulation of Mitochondrial Disaggregase ClpX with Its Interacting Nucleoid Proteins, and of mtDNA. Cells. 2021;10(12) PubMed |
Pietras, Zbigniew; Wojcik, Magdalena A; Borowski, Lukasz S; Szewczyk, Maciej; Kulinski, Tomasz M; Cysewski, Dominik; Stepien, Piotr P; Dziembowski, Andrzej; Szczesny, Roman J. Dedicated surveillance mechanism controls G-quadruplex forming non-coding RNAs in human mitochondria. Nature Communications. 2018;9(1):2558. PubMed |
Hensen, Fenna; Potter, Alisa; van Esveld, Selma L; Tarrés-Solé, Aleix; Chakraborty, Arka; Solà, Maria; Spelbrink, Johannes N. Mitochondrial RNA granules are critically dependent on mtDNA replication factors Twinkle and mtSSB. Nucleic Acids Research. 2019;47(7):3680-3698. PubMed |
Piro-Mégy, Camille; Sarzi, Emmanuelle; Tarrés-Solé, Aleix; Péquignot, Marie; Hensen, Fenna; Quilès, Mélanie; Manes, Gaël; Chakraborty, Arka; Sénéchal, Audrey; Bocquet, Béatrice; Cazevieille, Chantal; Roubertie, Agathe; Müller, Agnès; Charif, Majida; Goudenège, David; Lenaers, Guy; Wilhelm, Helmut; Kellner, Ulrich; Weisschuh, Nicole; Wissinger, Bernd; Zanlonghi, Xavier; Hamel, Christian; Spelbrink, Johannes N; Sola, Maria; Delettre, Cécile. Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy. The Journal Of Clinical Investigation. 2020;130(1):143-156. PubMed |
van Esveld, Selma L; Cansız-Arda, Şirin; Hensen, Fenna; van der Lee, Robin; Huynen, Martijn A; Spelbrink, Johannes N. A Combined Mass Spectrometry and Data Integration Approach to Predict the Mitochondrial Poly(A) RNA Interacting Proteome. Frontiers In Cell And Developmental Biology. 7( 31803741):283. PubMed |
Rey, Timo; Zaganelli, Sofia; Cuillery, Emilie; Vartholomaiou, Evangelia; Croisier, Marie; Martinou, Jean-Claude; Manley, Suliana. Mitochondrial RNA granules are fluid condensates positioned by membrane dynamics. Nature Cell Biology. 2020;22(10):1180-1186. PubMed |
Nasonovs, Aleksandrs; Garcia-Diaz, Miguel; Bogenhagen, Daniel F. A549 cells contain enlarged mitochondria with independently functional clustered mtDNA nucleoids. Plos One. 16(3):e0249047. PubMed |
van Esveld, Selma L; Rodenburg, Richard J; Al-Murshedi, Fathiya; Al-Ajmi, Eiman; Al-Zuhaibi, Sana; Huynen, Martijn A; Spelbrink, Johannes N. Mitochondrial RNA processing defect caused by a SUPV3L1 mutation in two siblings with a novel neurodegenerative syndrome. Journal Of Inherited Metabolic Disease. 2022;45(2):292-307. PubMed |
Dumoulin, Bernhard; Heydeck, Dagmar; Jähn, Desiree; Lassé, Moritz; Sofi, Sajad; Ufer, Christoph; Kuhn, Hartmut. Male guanine-rich RNA sequence binding factor 1 knockout mice (Grsf1(-/-)) gain less body weight during adolescence and adulthood. Cell & Bioscience. 2022;12(1):199. PubMed |
Key, Jana; Gispert, Suzana; Koornneef, Lieke; Sleddens-Linkels, Esther; Kohli, Aneesha; Torres-Odio, Sylvia; Koepf, Gabriele; Amr, Shady; Reichlmeir, Marina; Harter, Patrick N; West, Andrew Phillip; Münch, Christian; Baarends, Willy M; Auburger, Georg. CLPP Depletion Causes Diplotene Arrest; Underlying Testis Mitochondrial Dysfunction Occurs with Accumulation of Perrault Proteins ERAL1, PEO1, and HARS2. Cells. 2022;12(1) PubMed |