Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036984-25

Protein Description: G-rich RNA sequence binding factor 1
Gene Name: GRSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044221: 89%, ENSRNOG00000003392: 88%
Entrez Gene ID: 2926
Uniprot ID: Q12849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
• Gene Sequence: YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
• Gene ID - Mouse: ENSMUSG00000044221
• Gene ID - Rat: ENSRNOG00000003392
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) – 1 Found

Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189.