Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036984-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GRSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044221: 89%, ENSRNOG00000003392: 88%
Entrez Gene ID: 2926
Uniprot ID: Q12849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN |
| Gene Sequence | YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN |
| Gene ID - Mouse | ENSMUSG00000044221 |
| Gene ID - Rat | ENSRNOG00000003392 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) | |
| Datasheet | Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) | |
| Datasheet | Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) |
| Citations for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) – 1 Found |
| Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189. PubMed |