Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036984-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G-rich RNA sequence binding factor 1
Gene Name: GRSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044221: 89%, ENSRNOG00000003392: 88%
Entrez Gene ID: 2926
Uniprot ID: Q12849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
Gene Sequence YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
Gene ID - Mouse ENSMUSG00000044221
Gene ID - Rat ENSRNOG00000003392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)
Datasheet Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)
Datasheet Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation)
Citations for Anti GRSF1 pAb (ATL-HPA036984 w/enhanced validation) – 1 Found
Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189.  PubMed