Anti GRPEL2 pAb (ATL-HPA023211)

Atlas Antibodies

SKU:
ATL-HPA023211-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GrpE-like 2, mitochondrial (E. coli)
Gene Name: GRPEL2
Alternative Gene Name: DKFZp451C205, FLJ23713, Mt-GrpE#2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024580: 83%, ENSRNOG00000042682: 83%
Entrez Gene ID: 134266
Uniprot ID: Q8TAA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
Gene Sequence VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
Gene ID - Mouse ENSMUSG00000024580
Gene ID - Rat ENSRNOG00000042682
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRPEL2 pAb (ATL-HPA023211)
Datasheet Anti GRPEL2 pAb (ATL-HPA023211) Datasheet (External Link)
Vendor Page Anti GRPEL2 pAb (ATL-HPA023211) at Atlas Antibodies

Documents & Links for Anti GRPEL2 pAb (ATL-HPA023211)
Datasheet Anti GRPEL2 pAb (ATL-HPA023211) Datasheet (External Link)
Vendor Page Anti GRPEL2 pAb (ATL-HPA023211)



Citations for Anti GRPEL2 pAb (ATL-HPA023211) – 1 Found
Tang, Chi-Tun; Li, Yao-Feng; Chou, Chung-Hsing; Huang, Li-Chun; Huang, Shih-Ming; Hueng, Dueng-Yuan; Tsai, Chia-Kuang; Chen, Yuan-Hao. GRPEL2 Knockdown Exerts Redox Regulation in Glioblastoma. International Journal Of Molecular Sciences. 2021;22(23)  PubMed