Anti GRPEL1 pAb (ATL-HPA036647 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036647-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
  • Western blot analysis in human cell lines PC-3 and HeLa using Anti-GRPEL1 antibody. Corresponding GRPEL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GrpE-like 1, mitochondrial (E. coli)
Gene Name: GRPEL1
Alternative Gene Name: FLJ25609, HMGE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029198: 89%, ENSRNOG00000006593: 88%
Entrez Gene ID: 80273
Uniprot ID: Q9HAV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK
Gene Sequence VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK
Gene ID - Mouse ENSMUSG00000029198
Gene ID - Rat ENSRNOG00000006593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GRPEL1 pAb (ATL-HPA036647 w/enhanced validation)
Datasheet Anti GRPEL1 pAb (ATL-HPA036647 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRPEL1 pAb (ATL-HPA036647 w/enhanced validation)