Anti GRN pAb (ATL-HPA028747)

Atlas Antibodies

Catalog No.:
ATL-HPA028747-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: granulin
Gene Name: GRN
Alternative Gene Name: CLN11, PCDGF, PGRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034708: 72%, ENSRNOG00000021031: 76%
Entrez Gene ID: 2896
Uniprot ID: P28799
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
Gene Sequence SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
Gene ID - Mouse ENSMUSG00000034708
Gene ID - Rat ENSRNOG00000021031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRN pAb (ATL-HPA028747)
Datasheet Anti GRN pAb (ATL-HPA028747) Datasheet (External Link)
Vendor Page Anti GRN pAb (ATL-HPA028747) at Atlas Antibodies

Documents & Links for Anti GRN pAb (ATL-HPA028747)
Datasheet Anti GRN pAb (ATL-HPA028747) Datasheet (External Link)
Vendor Page Anti GRN pAb (ATL-HPA028747)
Citations for Anti GRN pAb (ATL-HPA028747) – 2 Found
Elkabets, Moshe; Gifford, Ann M; Scheel, Christina; Nilsson, Bjorn; Reinhardt, Ferenc; Bray, Mark-Anthony; Carpenter, Anne E; Jirström, Karin; Magnusson, Kristina; Ebert, Benjamin L; Pontén, Fredrik; Weinberg, Robert A; McAllister, Sandra S. Human tumors instigate granulin-expressing hematopoietic cells that promote malignancy by activating stromal fibroblasts in mice. The Journal Of Clinical Investigation. 2011;121(2):784-99.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed