Anti GRN pAb (ATL-HPA008763 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008763-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GRN
Alternative Gene Name: CLN11, PCDGF, PGRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034708: 84%, ENSRNOG00000021031: 83%
Entrez Gene ID: 2896
Uniprot ID: P28799
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL |
| Gene Sequence | DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL |
| Gene ID - Mouse | ENSMUSG00000034708 |
| Gene ID - Rat | ENSRNOG00000021031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRN pAb (ATL-HPA008763 w/enhanced validation) | |
| Datasheet | Anti GRN pAb (ATL-HPA008763 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRN pAb (ATL-HPA008763 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GRN pAb (ATL-HPA008763 w/enhanced validation) | |
| Datasheet | Anti GRN pAb (ATL-HPA008763 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GRN pAb (ATL-HPA008763 w/enhanced validation) |
| Citations for Anti GRN pAb (ATL-HPA008763 w/enhanced validation) – 6 Found |
| Holler, Christopher J; Taylor, Georgia; Deng, Qiudong; Kukar, Thomas. Intracellular Proteolysis of Progranulin Generates Stable, Lysosomal Granulins that Are Haploinsufficient in Patients with Frontotemporal Dementia Caused by GRN Mutations. Eneuro. 2017;4(4) PubMed |
| Upontain, Songkiad; Sereerak, Piya; Laha, Thewarach; Sripa, Banchob; Tangkawatana, Prasarn; Brindley, Paul J; Tangkawatana, Sirikachorn. Granulin Expression in Hamsters during Opisthorchis viverrini Infection-Induced Cholangiocarcinogenesis. Asian Pacific Journal Of Cancer Prevention : Apjcp. 2018;19(9):2437-2445. PubMed |
| Elkabets, Moshe; Gifford, Ann M; Scheel, Christina; Nilsson, Bjorn; Reinhardt, Ferenc; Bray, Mark-Anthony; Carpenter, Anne E; Jirström, Karin; Magnusson, Kristina; Ebert, Benjamin L; Pontén, Fredrik; Weinberg, Robert A; McAllister, Sandra S. Human tumors instigate granulin-expressing hematopoietic cells that promote malignancy by activating stromal fibroblasts in mice. The Journal Of Clinical Investigation. 2011;121(2):784-99. PubMed |
| Nguyen, Andrew D; Nguyen, Thi A; Zhang, Jiasheng; Devireddy, Swathi; Zhou, Ping; Karydas, Anna M; Xu, Xialian; Miller, Bruce L; Rigo, Frank; Ferguson, Shawn M; Huang, Eric J; Walther, Tobias C; Farese, Robert V Jr. Murine knockin model for progranulin-deficient frontotemporal dementia with nonsense-mediated mRNA decay. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(12):E2849-E2858. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Frew, Jonathan; Baradaran-Heravi, Alireza; Balgi, Aruna D; Wu, Xiujuan; Yan, Tyler D; Arns, Steve; Shidmoossavee, Fahimeh S; Tan, Jason; Jaquith, James B; Jansen-West, Karen R; Lynn, Francis C; Gao, Fen-Biao; Petrucelli, Leonard; Feldman, Howard H; Mackenzie, Ian R; Roberge, Michel; Nygaard, Haakon B. Premature termination codon readthrough upregulates progranulin expression and improves lysosomal function in preclinical models of GRN deficiency. Molecular Neurodegeneration. 2020;15(1):21. PubMed |