Anti GRN pAb (ATL-HPA008763 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008763-25

Protein Description: granulin
Gene Name: GRN
Alternative Gene Name: CLN11, PCDGF, PGRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034708: 84%, ENSRNOG00000021031: 83%
Entrez Gene ID: 2896
Uniprot ID: P28799
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL
• Gene Sequence: DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL
• Gene ID - Mouse: ENSMUSG00000034708
• Gene ID - Rat: ENSRNOG00000021031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GRN pAb (ATL-HPA008763 w/enhanced validation) – 6 Found

Holler, Christopher J; Taylor, Georgia; Deng, Qiudong; Kukar, Thomas. Intracellular Proteolysis of Progranulin Generates Stable, Lysosomal Granulins that Are Haploinsufficient in Patients with Frontotemporal Dementia Caused by GRN Mutations. Eneuro. 2017;4(4) 

Upontain, Songkiad; Sereerak, Piya; Laha, Thewarach; Sripa, Banchob; Tangkawatana, Prasarn; Brindley, Paul J; Tangkawatana, Sirikachorn. Granulin Expression in Hamsters during Opisthorchis viverrini Infection-Induced Cholangiocarcinogenesis. Asian Pacific Journal Of Cancer Prevention : Apjcp. 2018;19(9):2437-2445. 

Elkabets, Moshe; Gifford, Ann M; Scheel, Christina; Nilsson, Bjorn; Reinhardt, Ferenc; Bray, Mark-Anthony; Carpenter, Anne E; Jirström, Karin; Magnusson, Kristina; Ebert, Benjamin L; Pontén, Fredrik; Weinberg, Robert A; McAllister, Sandra S. Human tumors instigate granulin-expressing hematopoietic cells that promote malignancy by activating stromal fibroblasts in mice. The Journal Of Clinical Investigation. 2011;121(2):784-99. 

Nguyen, Andrew D; Nguyen, Thi A; Zhang, Jiasheng; Devireddy, Swathi; Zhou, Ping; Karydas, Anna M; Xu, Xialian; Miller, Bruce L; Rigo, Frank; Ferguson, Shawn M; Huang, Eric J; Walther, Tobias C; Farese, Robert V Jr. Murine knockin model for progranulin-deficient frontotemporal dementia with nonsense-mediated mRNA decay. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(12):E2849-E2858. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Frew, Jonathan; Baradaran-Heravi, Alireza; Balgi, Aruna D; Wu, Xiujuan; Yan, Tyler D; Arns, Steve; Shidmoossavee, Fahimeh S; Tan, Jason; Jaquith, James B; Jansen-West, Karen R; Lynn, Francis C; Gao, Fen-Biao; Petrucelli, Leonard; Feldman, Howard H; Mackenzie, Ian R; Roberge, Michel; Nygaard, Haakon B. Premature termination codon readthrough upregulates progranulin expression and improves lysosomal function in preclinical models of GRN deficiency. Molecular Neurodegeneration. 2020;15(1):21.