Anti GRK5 pAb (ATL-HPA046838)

Atlas Antibodies

Catalog No.:
ATL-HPA046838-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor kinase 5
Gene Name: GRK5
Alternative Gene Name: GPRK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003228: 91%, ENSRNOG00000011439: 89%
Entrez Gene ID: 2869
Uniprot ID: P34947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
Gene Sequence KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
Gene ID - Mouse ENSMUSG00000003228
Gene ID - Rat ENSRNOG00000011439
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRK5 pAb (ATL-HPA046838)
Datasheet Anti GRK5 pAb (ATL-HPA046838) Datasheet (External Link)
Vendor Page Anti GRK5 pAb (ATL-HPA046838) at Atlas Antibodies

Documents & Links for Anti GRK5 pAb (ATL-HPA046838)
Datasheet Anti GRK5 pAb (ATL-HPA046838) Datasheet (External Link)
Vendor Page Anti GRK5 pAb (ATL-HPA046838)