Anti GRK5 pAb (ATL-HPA046838)
Atlas Antibodies
- SKU:
- ATL-HPA046838-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GRK5
Alternative Gene Name: GPRK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003228: 91%, ENSRNOG00000011439: 89%
Entrez Gene ID: 2869
Uniprot ID: P34947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL |
Gene Sequence | KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL |
Gene ID - Mouse | ENSMUSG00000003228 |
Gene ID - Rat | ENSRNOG00000011439 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRK5 pAb (ATL-HPA046838) | |
Datasheet | Anti GRK5 pAb (ATL-HPA046838) Datasheet (External Link) |
Vendor Page | Anti GRK5 pAb (ATL-HPA046838) at Atlas Antibodies |
Documents & Links for Anti GRK5 pAb (ATL-HPA046838) | |
Datasheet | Anti GRK5 pAb (ATL-HPA046838) Datasheet (External Link) |
Vendor Page | Anti GRK5 pAb (ATL-HPA046838) |