Anti GRIK2 pAb (ATL-HPA014623)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014623-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL |
| Gene Sequence | ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL |
| Gene ID - Mouse | ENSMUSG00000056073 |
| Gene ID - Rat | ENSRNOG00000000368 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
| Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
| Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) at Atlas Antibodies |
| Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
| Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
| Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) |